If you have been reading about synthetic peptide and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-03-25. Numbers and descriptions here follow the published literature rather than marketing material.
Regulatory status: AOD-9604 is not approved as a therapeutic drug in the United States, European Union, or other major markets. It is listed by the World Anti-Doping Agency as a prohibited substance in sport, specifically under growth hormone fragments. Many jurisdictions restrict its sale for human consumption. Products marketed online may not meet pharmaceutical quality standards. The legal status varies by country and often depends on whether the material is presented as a research chemical, supplement, or drug.
Detection and characterization of AOD-9604 in research and anti-doping settings typically rely on mass spectrometry coupled with liquid chromatography. These methods can identify the peptide by its mass and fragmentation pattern. Immunoassays may also be used in some screening contexts, but they can cross-react with related peptides. Because the molecule is small and may be present at low concentrations, sample preparation and method validation are important. Confirmatory analysis usually requires comparison with a certified reference standard.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It is often described as hGH fragment 176-191. Research interest arose because it was designed to isolate possible effects on fat metabolism from other actions of growth hormone. It is not a full growth hormone molecule. Its development history includes early laboratory and animal studies followed by human trials. The peptide has been examined in laboratory, animal, and limited human studies.
The compound has been studied as a potential treatment for obesity and related metabolic conditions. Published trials have examined changes in body weight, fat mass, and safety markers over limited durations. Results have been mixed or modest, and no large-scale outcome trials are established. Regulatory agencies in several countries have not approved it as a therapeutic drug. Some commercial products have been marketed outside regulated pharmaceutical channels, which raises questions about quality and claims.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Not approved as a medicine | Status varies by country; prohibited in sport. |
| Common storage temperature | 2–8 °C for lyophilized powder | Protect from light and moisture; follow supplier instructions. |
| Typical analytical method | LC-MS/MS | Used for identification and quantification in biological samples. |
| Purity assessment | HPLC and mass spectrometry | Reverse-phase HPLC is common for peptide purity. |
| Common synonyms | AOD9604; hGH 176-191 fragment | Naming conventions differ across studies. |
Several names appear in scientific and commercial settings. AOD9604 and AOD-9604 are development codes used interchangeably, while hGH fragment 176-191 describes the same region. The peptide includes a disulfide bond between two cysteine residues, which helps shape its three-dimensional structure. Different suppliers may provide acetate or other salt forms, and purity can vary. These differences matter because analytical tests and biological assays can respond to the specific form being studied.
Early interest in AOD-9604 centered on whether a fragment of human growth hormone could influence fat metabolism without the broader effects of the full hormone. Cell and animal studies reported changes in fat storage and breakdown. Human trials followed, but the results were not strong enough to secure regulatory approval. The compound remains available for laboratory research, and its clinical potential is still described as uncertain. Studies continue to examine its activity and safety profile.
AOD-9604 is a synthetic peptide whose sequence matches the C-terminal fragment of human growth hormone, specifically residues 176 through 191. This region differs from the full hormone in its receptor interactions. The peptide is not a growth hormone secretagogue and does not bind the growth hormone receptor in the same manner. Researchers have examined it for effects on lipid metabolism, but its exact pharmacological profile remains an active area of study.
Development of AOD-9604 began in the 1990s as scientists sought to isolate metabolic effects of growth hormone without its growth-promoting actions. Early laboratory work focused on fat cells and animal models. Several human trials followed, examining changes in body composition and fat mass. Results have been mixed, and the peptide has not progressed to widespread clinical approval. Interest continues in research settings, particularly regarding its mechanism and potential metabolic targets.
Regulatory status varies by country. In the United States, AOD-9604 is not approved as a prescription drug. It is sometimes sold as a research chemical or dietary supplement, though such marketing may fall outside legal frameworks. The World Anti-Doping Agency prohibits its use in sport. Researchers must obtain it through legitimate suppliers and follow institutional rules. Its legal classification continues to evolve as authorities increasingly assess peptide products more broadly.
Subsequently, Hezbollah decreased its military operations briefly which also prompted the IDF to decrease its shelling of targets in southern Lebanon. Many displaced civilians reportedly returned to their homes amid the calm. Still, Hezbollah claimed 23 other attacks into northern Israel until the breaking of the ceasefire on 30 November. On 25 November, a UNIFIL patrol unit was hit by IDF gunfire in the vicinity of Aitaroun where there were no casualties. UNIFIL condemned the incident and called on parties to be reminded "of their obligations to protect peacekeepers and avoid putting the men and women who are working to restore stability at risk."
Radioactive waste is a type of hazardous waste that contains radioactive material. It is a result of various activities, including nuclear medicine, nuclear research, nuclear power generation, nuclear decommissioning, rare-earth mining, and nuclear weapons reprocessing. The storage and disposal of radioactive waste is regulated by government agencies in order to protect human health and the environment. Radioactive waste is broadly classified into three categories: low-level waste (LLW), such as paper, rags, tools, and clothing, which contain small amounts of mostly short-lived radioactivity; intermediate-level waste (ILW), which contains higher amounts of radioactivity and requires some shielding; and high-level waste (HLW), which is highly radioactive and hot due to decay heat, thus requiring cooling and shielding. Spent nuclear fuel can be processed in nuclear reprocessing plants. One third of the total amount has already been reprocessed. With nuclear reprocessing, 96% of the spent fuel can be recycled back into uranium-based and mixed-oxide (MOX) fuels. The residual 4% is minor actinides and fission products, the latter of which are a mixture of stable and quickly decaying (most likely already having decayed in the spent fuel pool) elements, medium lived fission products such as strontium-90 and caesium-137 and finally seven long-lived fission products with half-lives in the hundreds of thousands to millions of years. The minor actinides, meanwhile, are heavy elements other than uranium and plutonium which are created by neutron capture.
=== Final tour and death in New York === Thomas left Laugharne on 9 October 1953 on the first leg of his fourth trip to America. He called on his mother, Florence, to say goodbye: "He always felt that he had to get out from this country because of his chest being so bad." Thomas had suffered from chest problems for most of his life, though they began in earnest soon after he moved in May 1949 to the Boat House at Laugharne—the "bronchial heronry", as he called it. Within weeks of moving in, he visited a local doctor, who prescribed medicine for both his chest and throat. While waiting in London before his flight, Thomas stayed with the comedian Harry Locke and worked on Under Milk Wood. Locke noted that Thomas was having trouble with his chest, "terrible" coughing fits that made him go purple in the face. He was also using an inhaler to help his breathing. There were reports, too, that Thomas was also having blackouts. His visit to the BBC producer Philip Burton, a few days before he left for New York, was interrupted by a blackout. On his last night in London, he had another in the company of his fellow poet Louis MacNeice. Thomas arrived in New York on 20 October 1953 to undertake further performances of Under Milk Wood, organised by John Brinnin, his American agent and Director of the Poetry Centre. Brinnin did not travel to New York but remained in Boston to write. He handed responsibility to his assistant, Liz Reitell. She met Thomas at Idlewild Airport and was shocked at his appearance.
Sources: en.wikipedia.org
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Burkett (1984), award-winning correspondent for WABC-TV Matthew Cooper (1984), Time magazine White House correspondent and defendant in the Valerie Plame investigation Tom Watson (1984), journalist, entrepreneur Thomas Vinciguerra (1985), journalist, editor and author Naftali Bendavid (1986), Congress correspondent for The Wall Street Journal Susan Benesch (1986), journalist, free speech advocate Elizabeth Rubin (1987), journalist for The New York Times Magazine, sister of Bloomberg News executive editor James Rubin '82 Aram Roston (1988), investigative journalist Edward Lewine (1989), author and freelance journalist Sam Marchiano (1989), television sportscaster, documentarian and activist, daughter of sportscaster Sal Marchiano David Streitfeld (1989), book reporter for The Washington Post; winner of the 2013 Pulitzer Prize for Explanatory Reporting Caroline Glick (1991), Israeli journalist, editor, writer Warren St. John (1991), journalist for The New York Times and former CEO of Patch Michael J. Socolow (1991), broadcast journalist and professor at the University of Maine Jesse Eisinger (1992), Pulitzer Prize-winning reporter for ProPublica Jean H.
In relation to the significance of the event(s) on career choice, when merging the categories ‘probably chosen career regardless’ with ‘possibly chosen career regardless’, and ‘unlikely chosen career regardless’ with ‘not considered career otherwise’, there is a slight majority in relation to the former. There are no significant differences in relation to demographic factors. In relation to whether one or more psychologically wounding experiences led to the choice of a career as a therapist, there is a significant difference within designation, gender, grouping gender and ethnicity, and, grouping gender and age. There are no significant differences within approach, ethnicity or age. The majority of the wounds were caused by events experienced directly by the respondents (65%) as opposed to indirectly or both. Within demographic factors, the causes of the wounding experiences leading to career choice are not statistically significant. The exact causes of the wounds vary enormously. The main categories are abuse, family life as a child, mental ill-health (own), social, family life as an adult, bereavement, mental ill-health (others), life-threatening, physical ill-health (others), physical ill-health (own), and, other. There are many implications for the future of the therapeutic world, focusing mainly on supervision and training. The largest prevalence study on lived experience within the mental health field by Victor et al.
During the Cold War, much of the policy and the infrastructure of the Western world and the Eastern Bloc had revolved around the capitalist and communist ideologies, respectively, and the possibility of a nuclear warfare. The end of the Cold War and the fall of the Soviet Union caused profound changes in nearly every society in the world. It enabled renewed attention to be paid to matters that were ignored during the Cold War and has paved the way for greater international cooperation, international organizations, and nationalist movements. The European Union expanded and further integrated, and power shifted from the G7 to the larger G20 economies. The outcome symbolized a victory of democracy and capitalism which became a manner of collective self-validation for countries hoping to gain international respect. With democracy being seen as an important value, more countries began adopting that value. Communism ended also in Mongolia, Congo, Albania, Yugoslavia, Afghanistan, and Angola. As of 2023, only five countries in the world are still ruled as communist states: China, Cuba, North Korea, Laos, and Vietnam.
Sources: en.wikipedia.org
== June 1, 1915 (Tuesday) == Gorlice–Tarnów Offensive — German infantry occupied three large forts around Przemyśl after a Russian counterattack failed. British light cruiser HMS Arethusa encountered a German airship on the North Sea and quickly launched a Sopwith seaplane to intercept. However, the pilot mistook smoke from British destroyers as a recall signal and abandoned the chase, ending one of the most promising early opportunities for the interception of an airship by a shipborne aircraft. The 107th Infantry Division of the Imperial German Army was established. The United States Department of the Navy awarded its first contract for an airship to the Connecticut Aircraft Company. Shinano Railway extended the Ōito Line in the Nagano Prefecture, Japan, with station Hakuyachō serving the line. As well, the Geibi Railway extended the Geibi Line in the Okayama Prefecture, Japan, with station Miyoshi serving the line. The second part of the Mandra–Bhaun Railway opened in British India (now Pakistan), connecting Mandra with Bhaun. The Sunset Beach Hotel opened in Glenwood Township, Pope County, Minnesota. It was added to the National Register of Historic Places in 1982.
terminator A DNA sequence or its RNA complement which signals the termination of transcription by triggering processes that ultimately arrest the activity of RNA polymerase and/or cause the release of the nascent RNA transcript from the transcriptional complex. Terminator sequences are usually found near the 3'-ends of the coding sequences of genes or operons. They generally function after being themselves transcribed into the nascent strand, whereupon the part of the strand containing the sequence either directly interacts with the transcriptional complex or a cofactor or forms a secondary structure such as a hairpin loop which signals the recruitment of enzymes that promote its disassembly.
== Diet == Like other blowflies, C. vomitoria colonize animal remains, including humans. While adult C. vomitoria feed on nectar, the larvae feed on corpses, the medium in which they grow. However, it has been shown that feeding on processed substrates (food that are modified for human consumption by increasing shelf life and taste through salting, curing, smoking, etc.) provided much better growth than unprocessed substrates such as raw unmodified liver. Because different substrates drastically affected growth, C. vomitoria is best characterized as a specialist that best utilizes processed substrates (minced meats, for example). Its close relative, Calliphora vicina, is a generalist, being able to utilize mixed substrates with equal growth rates. In the case of overcrowding, C. vomitoria competition results in compensation by increased speed of development, leading to smaller larvae and adults. This has complications in forensics because different parts of the body would grow at different rates. Additionally, it has been shown that the fly larvae are able to colonize even buried remains. Growth rates are similar between surface and buried larvae. Usually, these flies lay their eggs around wounds on fresh corpses shortly after death. Right before the pupal stage, the fly larvae that leaves the carrion can burrow into the soil in order to pupate. Then, adult flies emerge. In decaying carcasses, it was found that Calliphoridae flies dominate, especially C. vomitoria. In both spring and fall, C. vomitoria is the primary species found on carcasses. In some cases, C.
Sources: en.wikipedia.org
No major regulatory agency has approved AOD-9604 as a medicine. It is treated as an experimental peptide in research settings. Some countries restrict its sale or import.
The World Anti-Doping Agency classifies growth hormone fragments, including AOD-9604, as prohibited substances. The classification reflects concern about potential performance-enhancing use. Athletes are subject to testing for such peptides.
Detection typically uses liquid chromatography combined with mass spectrometry. These methods separate the peptide and identify it by mass. Immunoassays may screen samples but require confirmation by a more specific technique.
It is a synthetic peptide fragment derived from the C-terminal region of human growth hormone, commonly referred to as hGH fragment 176-191. It has been investigated for effects on fat metabolism, but it is not an approved medication in most jurisdictions.